MAGEB2,CT3.2,DAM6
  • MAGEB2,CT3.2,DAM6

Anti-MAGEB2 Antibody 25ul

Ref: AN-HPA065224-25ul
Anti-MAGEB2

Información del producto

Polyclonal Antibody against Human MAGEB2, Gene description: melanoma antigen family B2, Alternative Gene Names: CT3.2, DAM6, MAGE-XP-2, MGC26438, Validated applications: ICC, Uniprot ID: O15479, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGEB2
Gene Description melanoma antigen family B2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Immunogen EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT3.2, DAM6, MAGE-XP-2, MGC26438
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15479
HTS Code 3002150000
Gene ID 4113
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGEB2 Antibody 25ul

Anti-MAGEB2 Antibody 25ul