PGBD5,DKFZp761A0620
  • PGBD5,DKFZp761A0620

Anti-PGBD5 Antibody 25ul

Ref: AN-HPA065010-25ul
Anti-PGBD5

Información del producto

Polyclonal Antibody against Human PGBD5, Gene description: piggyBac transposable element derived 5, Alternative Gene Names: DKFZp761A0620, FLJ11413, Validated applications: ICC, Uniprot ID: Q8N414, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PGBD5
Gene Description piggyBac transposable element derived 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Immunogen LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp761A0620, FLJ11413
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N414
HTS Code 3002150000
Gene ID 79605
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PGBD5 Antibody 25ul

Anti-PGBD5 Antibody 25ul