NAIF1,bA379C10.2
  • NAIF1,bA379C10.2

Anti-NAIF1 Antibody 25ul

Ref: AN-HPA064931-25ul
Anti-NAIF1

Información del producto

Polyclonal Antibody against Human NAIF1, Gene description: nuclear apoptosis inducing factor 1, Alternative Gene Names: bA379C10.2, C9orf90, DKFZp762G199, Validated applications: ICC, Uniprot ID: Q69YI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NAIF1
Gene Description nuclear apoptosis inducing factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ
Immunogen EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA379C10.2, C9orf90, DKFZp762G199
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q69YI7
HTS Code 3002150000
Gene ID 203245
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NAIF1 Antibody 25ul

Anti-NAIF1 Antibody 25ul