TCERG1,CA150,TAF2S
  • TCERG1,CA150,TAF2S

Anti-TCERG1 Antibody 25ul

Ref: AN-HPA064854-25ul
Anti-TCERG1

Información del producto

Polyclonal Antibody against Human TCERG1, Gene description: transcription elongation regulator 1, Alternative Gene Names: CA150, TAF2S, Urn1, Validated applications: IHC, Uniprot ID: O14776, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCERG1
Gene Description transcription elongation regulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Immunogen KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CA150, TAF2S, Urn1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14776
HTS Code 3002150000
Gene ID 10915
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCERG1 Antibody 25ul

Anti-TCERG1 Antibody 25ul