Anti-CIC Antibody 100ul

Ref: AN-HPA064725-100ul
Anti-CIC

Información del producto

Polyclonal Antibody against Human CIC, Gene description: capicua transcriptional repressor, Alternative Gene Names: KIAA0306, Validated applications: ICC, Uniprot ID: Q96RK0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Species Reactivity Cross Human
Applications ICC
Sequence MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP
Immunogen MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0306
Categoria Polyclonal
Isoelectric Point IgG
UniProt ID Q96RK0
HTS Code 3002150000
Gene ID 23152
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CIC Antibody 100ul

Anti-CIC Antibody 100ul