SMARCA1,hSNF2L,ISWI
  • SMARCA1,hSNF2L,ISWI

Anti-SMARCA1 Antibody 25ul

Ref: AN-HPA064712-25ul
Anti-SMARCA1

Información del producto

Polyclonal Antibody against Human SMARCA1, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1, Alternative Gene Names: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI, Validated applications: ICC, Uniprot ID: P28370, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SMARCA1
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
Immunogen KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28370
HTS Code 3002150000
Gene ID 6594
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SMARCA1 Antibody 25ul

Anti-SMARCA1 Antibody 25ul