XRCC5,KARP-1,KU80
  • XRCC5,KARP-1,KU80

Anti-XRCC5 Antibody 25ul

Ref: AN-HPA064685-25ul
Anti-XRCC5

Información del producto

Polyclonal Antibody against Human XRCC5, Gene description: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), Alternative Gene Names: KARP-1, KU80, Ku86, KUB2, Validated applications: ICC, Uniprot ID: P13010, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name XRCC5
Gene Description X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Immunogen SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KARP-1, KU80, Ku86, KUB2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13010
HTS Code 3002150000
Gene ID 7520
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-XRCC5 Antibody 25ul

Anti-XRCC5 Antibody 25ul