TBX5,HOS
  • TBX5,HOS

Anti-TBX5 Antibody 100ul

Ref: AN-HPA064683-100ul
Anti-TBX5

Información del producto

Polyclonal Antibody against Human TBX5, Gene description: T-box 5, Alternative Gene Names: HOS, Validated applications: ICC, Uniprot ID: Q99593, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TBX5
Gene Description T-box 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Immunogen PRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99593
HTS Code 3002150000
Gene ID 6910
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TBX5 Antibody 100ul

Anti-TBX5 Antibody 100ul