EMILIN2,FLJ33200
  • EMILIN2,FLJ33200

Anti-EMILIN2 Antibody 25ul

Ref: AN-HPA064576-25ul
Anti-EMILIN2

Información del producto

Polyclonal Antibody against Human EMILIN2, Gene description: elastin microfibril interfacer 2, Alternative Gene Names: FLJ33200, FOAP-10, Validated applications: IHC, Uniprot ID: Q9BXX0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EMILIN2
Gene Description elastin microfibril interfacer 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT
Immunogen RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ33200, FOAP-10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXX0
HTS Code 3002150000
Gene ID 84034
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EMILIN2 Antibody 25ul

Anti-EMILIN2 Antibody 25ul