AN-HPA064572-25ul
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 25ul |
Gene Name | IPO4 |
Gene Description | importin 4 |
Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Shipping Conditions | Normally shipped at ambient temperature |
Species Reactivity Cross | Human |
Applications | WB, ICC |
Sequence | VRDNICGALARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPD |
Immunogen | VRDNICGALARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPD |
Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Product Group | Polyclonal Antibodies |
Alternative Names | FLJ23338, Imp4 |
Categoria | Polyclonal |
Isoelectric Point | IgG |
Host | RABBIT |
UniProt ID | Q8TEX9 |
HTS Code | 3002150000 |
Gene ID | 79711 |
Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification | Affinity purified using the PrEST antigen as affinity ligand |
Iso type | IgG |
Aplicación | WB, ICC |
Conjugation | Unconjugated |