RASA1,CM-AVM,GAP
  • RASA1,CM-AVM,GAP

Anti-RASA1 Antibody 100ul

Ref: AN-HPA064556-100ul
Anti-RASA1

Información del producto

Polyclonal Antibody against Human RASA1, Gene description: RAS p21 protein activator (GTPase activating protein) 1, Alternative Gene Names: CM-AVM, GAP, p120GAP, p120RASGAP, RASA, Validated applications: IHC, Uniprot ID: P20936, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RASA1
Gene Description RAS p21 protein activator (GTPase activating protein) 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Immunogen AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CM-AVM, GAP, p120GAP, p120RASGAP, RASA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20936
HTS Code 3002150000
Gene ID 5921
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RASA1 Antibody 100ul

Anti-RASA1 Antibody 100ul