SLC30A10
  • SLC30A10

Anti-SLC30A10 Antibody 100ul

Ref: AN-HPA064547-100ul
Anti-SLC30A10

Información del producto

Polyclonal Antibody against Human SLC30A10, Gene description: solute carrier family 30 member 10, Alternative Gene Names: DKFZp547M236, ZnT-10, ZNT8, ZRC1, Validated applications: IHC, Uniprot ID: Q6XR72, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC30A10
Gene Description solute carrier family 30 member 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL
Immunogen SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547M236, ZnT-10, ZNT8, ZRC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6XR72
HTS Code 3002150000
Gene ID 55532
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC30A10 Antibody 100ul

Anti-SLC30A10 Antibody 100ul