LYSMD1,MGC35223
  • LYSMD1,MGC35223

Anti-LYSMD1 Antibody 25ul

Ref: AN-HPA064537-25ul
Anti-LYSMD1

Información del producto

Polyclonal Antibody against Human LYSMD1, Gene description: LysM, putative peptidoglycan-binding, domain containing 1, Alternative Gene Names: MGC35223, RP11-68I18.5, SB145, Validated applications: ICC, Uniprot ID: Q96S90, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LYSMD1
Gene Description LysM, putative peptidoglycan-binding, domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
Immunogen PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC35223, RP11-68I18.5, SB145
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96S90
HTS Code 3002150000
Gene ID 388695
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LYSMD1 Antibody 25ul

Anti-LYSMD1 Antibody 25ul