SEZ6L2,FLJ90517
  • SEZ6L2,FLJ90517

Anti-SEZ6L2 Antibody 100ul

Ref: AN-HPA064471-100ul
Anti-SEZ6L2

Información del producto

Polyclonal Antibody against Human SEZ6L2, Gene description: seizure related 6 homolog (mouse)-like 2, Alternative Gene Names: FLJ90517, PSK-1, Validated applications: IHC, Uniprot ID: Q6UXD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEZ6L2
Gene Description seizure related 6 homolog (mouse)-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
Immunogen RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90517, PSK-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UXD5
HTS Code 3002150000
Gene ID 26470
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEZ6L2 Antibody 100ul

Anti-SEZ6L2 Antibody 100ul