GPR37L1,ETBR-LP-2
  • GPR37L1,ETBR-LP-2

Anti-GPR37L1 Antibody 25ul

Ref: AN-HPA064454-25ul
Anti-GPR37L1

Información del producto

Polyclonal Antibody against Human GPR37L1, Gene description: G protein-coupled receptor 37 like 1, Alternative Gene Names: ETBR-LP-2, Validated applications: IHC, Uniprot ID: O60883, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GPR37L1
Gene Description G protein-coupled receptor 37 like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
Immunogen AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ETBR-LP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60883
HTS Code 3002150000
Gene ID 9283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GPR37L1 Antibody 25ul

Anti-GPR37L1 Antibody 25ul