SPRED2,FLJ21897
  • SPRED2,FLJ21897

Anti-SPRED2 Antibody 100ul

Ref: AN-HPA064394-100ul
Anti-SPRED2

Información del producto

Polyclonal Antibody against Human SPRED2, Gene description: sprouty related EVH1 domain containing 2, Alternative Gene Names: FLJ21897, FLJ31917, Spred-2, Validated applications: IHC, Uniprot ID: Q7Z698, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPRED2
Gene Description sprouty related EVH1 domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP
Immunogen EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ21897, FLJ31917, Spred-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z698
HTS Code 3002150000
Gene ID 200734
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPRED2 Antibody 100ul

Anti-SPRED2 Antibody 100ul