ARHGAP6,rhoGAPX-1
  • ARHGAP6,rhoGAPX-1

Anti-ARHGAP6 Antibody 100ul

Ref: AN-HPA064390-100ul
Anti-ARHGAP6

Información del producto

Polyclonal Antibody against Human ARHGAP6, Gene description: Rho GTPase activating protein 6, Alternative Gene Names: rhoGAPX-1, Validated applications: IHC, Uniprot ID: O43182, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGAP6
Gene Description Rho GTPase activating protein 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS
Immunogen SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names rhoGAPX-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43182
HTS Code 3002150000
Gene ID 395
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGAP6 Antibody 100ul

Anti-ARHGAP6 Antibody 100ul