PSMC5,p45,p45/SUG
  • PSMC5,p45,p45/SUG

Anti-PSMC5 Antibody 100ul

Ref: AN-HPA064293-100ul
Anti-PSMC5

Información del producto

Polyclonal Antibody against Human PSMC5, Gene description: proteasome 26S subunit, ATPase 5, Alternative Gene Names: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1, Validated applications: ICC, IHC, Uniprot ID: P62195, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMC5
Gene Description proteasome 26S subunit, ATPase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Immunogen VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62195
HTS Code 3002150000
Gene ID 5705
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSMC5 Antibody 100ul

Anti-PSMC5 Antibody 100ul