SNRPG,Sm-G
  • SNRPG,Sm-G

Anti-SNRPG Antibody 25ul

Ref: AN-HPA064152-25ul
Anti-SNRPG

Información del producto

Polyclonal Antibody against Human SNRPG, Gene description: small nuclear ribonucleoprotein polypeptide G, Alternative Gene Names: Sm-G, Validated applications: IHC, Uniprot ID: P62308, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNRPG
Gene Description small nuclear ribonucleoprotein polypeptide G
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RHVQGILRGFDPFMNLVIDECVEMATSGQQ
Immunogen RHVQGILRGFDPFMNLVIDECVEMATSGQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Sm-G
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62308
HTS Code 3002150000
Gene ID 6637
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNRPG Antibody 25ul

Anti-SNRPG Antibody 25ul