KLF12,AP-2rep
  • KLF12,AP-2rep

Anti-KLF12 Antibody 100ul

Ref: AN-HPA064146-100ul
Anti-KLF12

Información del producto

Polyclonal Antibody against Human KLF12, Gene description: Kruppel-like factor 12, Alternative Gene Names: AP-2rep, AP2REP, HSPC122, Validated applications: ICC, Uniprot ID: Q9Y4X4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLF12
Gene Description Kruppel-like factor 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN
Immunogen IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-2rep, AP2REP, HSPC122
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y4X4
HTS Code 3002150000
Gene ID 11278
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLF12 Antibody 100ul

Anti-KLF12 Antibody 100ul