PRR3,CAT56
  • PRR3,CAT56

Anti-PRR3 Antibody 25ul

Ref: AN-HPA064061-25ul
Anti-PRR3

Información del producto

Polyclonal Antibody against Human PRR3, Gene description: proline rich 3, Alternative Gene Names: CAT56, Em:AB014077.1, Em:AB023052.2, Validated applications: ICC, Uniprot ID: P79522, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRR3
Gene Description proline rich 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRH
Immunogen LSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAT56, Em:AB014077.1, Em:AB023052.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P79522
HTS Code 3002150000
Gene ID 80742
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRR3 Antibody 25ul

Anti-PRR3 Antibody 25ul