CYP24A1,CP24,CYP24
  • CYP24A1,CP24,CYP24

Anti-CYP24A1 Antibody 25ul

Ref: AN-HPA063771-25ul
Anti-CYP24A1

Información del producto

Polyclonal Antibody against Human CYP24A1, Gene description: cytochrome P450, family 24, subfamily A, polypeptide 1, Alternative Gene Names: CP24, CYP24, P450-CC24, Validated applications: ICC, Uniprot ID: Q07973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYP24A1
Gene Description cytochrome P450, family 24, subfamily A, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
Immunogen KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CP24, CYP24, P450-CC24
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07973
HTS Code 3002150000
Gene ID 1591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYP24A1 Antibody 25ul

Anti-CYP24A1 Antibody 25ul