NDUFB1,CI-MNLL,MNLL
  • NDUFB1,CI-MNLL,MNLL

Anti-NDUFB1 Antibody 25ul

Ref: AN-HPA063737-25ul
Anti-NDUFB1

Información del producto

Polyclonal Antibody against Human NDUFB1, Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa, Alternative Gene Names: CI-MNLL, MNLL, Validated applications: ICC, WB, Uniprot ID: O75438, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDUFB1
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Immunogen LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-MNLL, MNLL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75438
HTS Code 3002150000
Gene ID 4707
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFB1 Antibody 25ul

Anti-NDUFB1 Antibody 25ul