ANKRD17,FLJ22206
  • ANKRD17,FLJ22206

Anti-ANKRD17 Antibody 100ul

Ref: AN-HPA063731-100ul
Anti-ANKRD17

Información del producto

Polyclonal Antibody against Human ANKRD17, Gene description: ankyrin repeat domain 17, Alternative Gene Names: FLJ22206, GTAR, KIAA0697, MASK2, NY-BR-16, Validated applications: ICC, Uniprot ID: O75179, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ANKRD17
Gene Description ankyrin repeat domain 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KEIDELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLP
Immunogen KEIDELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22206, GTAR, KIAA0697, MASK2, NY-BR-16
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75179
HTS Code 3002150000
Gene ID 26057
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKRD17 Antibody 100ul

Anti-ANKRD17 Antibody 100ul