PPARG,NR1C3,PPARG1
  • PPARG,NR1C3,PPARG1

Anti-PPARG Antibody 100ul

Ref: AN-HPA063663-100ul
Anti-PPARG

Información del producto

Polyclonal Antibody against Human PPARG, Gene description: peroxisome proliferator-activated receptor gamma, Alternative Gene Names: NR1C3, PPARG1, PPARG2, PPARgamma, Validated applications: ICC, WB, Uniprot ID: P37231, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPARG
Gene Description peroxisome proliferator-activated receptor gamma
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
Immunogen DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NR1C3, PPARG1, PPARG2, PPARgamma
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P37231
HTS Code 3002150000
Gene ID 5468
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPARG Antibody 100ul

Anti-PPARG Antibody 100ul