TAF15,hTAFII68,Npl3
  • TAF15,hTAFII68,Npl3

Anti-TAF15 Antibody 25ul

Ref: AN-HPA063647-25ul
Anti-TAF15

Información del producto

Polyclonal Antibody against Human TAF15, Gene description: TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa, Alternative Gene Names: hTAFII68, Npl3, RBP56, TAF2N, Validated applications: ICC, WB, Uniprot ID: Q92804, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF15
Gene Description TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY
Immunogen SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hTAFII68, Npl3, RBP56, TAF2N
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92804
HTS Code 3002150000
Gene ID 8148
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAF15 Antibody 25ul

Anti-TAF15 Antibody 25ul