HEY1,bHLHb31,CHF-2
  • HEY1,bHLHb31,CHF-2

Anti-HEY1 Antibody 100ul

Ref: AN-HPA063472-100ul
Anti-HEY1

Información del producto

Polyclonal Antibody against Human HEY1, Gene description: hes-related family bHLH transcription factor with YRPW motif 1, Alternative Gene Names: bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1, Validated applications: ICC, Uniprot ID: Q9Y5J3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HEY1
Gene Description hes-related family bHLH transcription factor with YRPW motif 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKR
Immunogen MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5J3
HTS Code 3002150000
Gene ID 23462
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HEY1 Antibody 100ul

Anti-HEY1 Antibody 100ul