DDX17,P72
  • DDX17,P72

Anti-DDX17 Antibody 25ul

Ref: AN-HPA063142-25ul
Anti-DDX17

Información del producto

Polyclonal Antibody against Human DDX17, Gene description: DEAD (Asp-Glu-Ala-Asp) box helicase 17, Alternative Gene Names: P72, Validated applications: ICC, IHC, WB, Uniprot ID: Q92841, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DDX17
Gene Description DEAD (Asp-Glu-Ala-Asp) box helicase 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ
Immunogen GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names P72
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92841
HTS Code 3002150000
Gene ID 10521
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX17 Antibody 25ul

Anti-DDX17 Antibody 25ul