TAX1BP3,TIP-1
  • TAX1BP3,TIP-1

Anti-TAX1BP3 Antibody 100ul

Ref: AN-HPA063078-100ul
Anti-TAX1BP3

Información del producto

Polyclonal Antibody against Human TAX1BP3, Gene description: Tax1 (human T-cell leukemia virus type I) binding protein 3, Alternative Gene Names: TIP-1, Validated applications: IHC, WB, Uniprot ID: O14907, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAX1BP3
Gene Description Tax1 (human T-cell leukemia virus type I) binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Immunogen PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TIP-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14907
HTS Code 3002150000
Gene ID 30851
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAX1BP3 Antibody 100ul

Anti-TAX1BP3 Antibody 100ul