OR2T1,OR1-25
  • OR2T1,OR1-25

Anti-OR2T1 Antibody 100ul

Ref: AN-HPA063064-100ul
Anti-OR2T1

Información del producto

Polyclonal Antibody against Human OR2T1, Gene description: olfactory receptor, family 2, subfamily T, member 1, Alternative Gene Names: OR1-25, Validated applications: IHC, Uniprot ID: O43869, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR2T1
Gene Description olfactory receptor, family 2, subfamily T, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
Immunogen PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OR1-25
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43869
HTS Code 3002150000
Gene ID 26696
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OR2T1 Antibody 100ul

Anti-OR2T1 Antibody 100ul