FAM177B,FLJ43505
  • FAM177B,FLJ43505

Anti-FAM177B Antibody 100ul

Ref: AN-HPA063059-100ul
Anti-FAM177B

Información del producto

Polyclonal Antibody against Human FAM177B, Gene description: family with sequence similarity 177, member B, Alternative Gene Names: FLJ43505, RP11-452F19.2, Validated applications: IHC, Uniprot ID: A6PVY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM177B
Gene Description family with sequence similarity 177, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
Immunogen TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ43505, RP11-452F19.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6PVY3
HTS Code 3002150000
Gene ID 400823
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM177B Antibody 100ul

Anti-FAM177B Antibody 100ul