JUND,AP-1
  • JUND,AP-1

Anti-JUND Antibody 100ul

Ref: AN-HPA063029-100ul
Anti-JUND

Información del producto

Polyclonal Antibody against Human JUND, Gene description: jun D proto-oncogene, Alternative Gene Names: AP-1, Validated applications: ICC, IHC, Uniprot ID: P17535, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name JUND
Gene Description jun D proto-oncogene
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED
Immunogen IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17535
HTS Code 3002150000
Gene ID 3727
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-JUND Antibody 100ul

Anti-JUND Antibody 100ul