BFSP2,CP47,CP49
  • BFSP2,CP47,CP49

Anti-BFSP2 Antibody 25ul

Ref: AN-HPA062959-25ul
Anti-BFSP2

Información del producto

Polyclonal Antibody against Human BFSP2, Gene description: beaded filament structural protein 2, phakinin, Alternative Gene Names: CP47, CP49, LIFL-L, phakinin, Validated applications: IHC, Uniprot ID: Q13515, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BFSP2
Gene Description beaded filament structural protein 2, phakinin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Immunogen YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CP47, CP49, LIFL-L, phakinin
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13515
HTS Code 3002150000
Gene ID 8419
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BFSP2 Antibody 25ul

Anti-BFSP2 Antibody 25ul