CHMP1B,C18orf2
  • CHMP1B,C18orf2

Anti-CHMP1B Antibody 25ul

Ref: AN-HPA062896-25ul
Anti-CHMP1B

Información del producto

Polyclonal Antibody against Human CHMP1B, Gene description: charged multivesicular body protein 1B, Alternative Gene Names: C18orf2, CHMP1.5, Vps46B, Validated applications: IHC, Uniprot ID: Q7LBR1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHMP1B
Gene Description charged multivesicular body protein 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT
Immunogen TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C18orf2, CHMP1.5, Vps46B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7LBR1
HTS Code 3002150000
Gene ID 57132
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHMP1B Antibody 25ul

Anti-CHMP1B Antibody 25ul