DUS3L,DUS3,FLJ13896
  • DUS3L,DUS3,FLJ13896

Anti-DUS3L Antibody 100ul

Ref: AN-HPA062846-100ul
Anti-DUS3L

Información del producto

Polyclonal Antibody against Human DUS3L, Gene description: dihydrouridine synthase 3-like, Alternative Gene Names: DUS3, FLJ13896, Validated applications: ICC, Uniprot ID: Q96G46, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUS3L
Gene Description dihydrouridine synthase 3-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELL
Immunogen DIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DUS3, FLJ13896
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96G46
HTS Code 3002150000
Gene ID 56931
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUS3L Antibody 100ul

Anti-DUS3L Antibody 100ul