RELT,FLJ14993
  • RELT,FLJ14993

Anti-RELT Antibody 100ul

Ref: AN-HPA062824-100ul
Anti-RELT

Información del producto

Polyclonal Antibody against Human RELT, Gene description: RELT tumor necrosis factor receptor, Alternative Gene Names: FLJ14993, TNFRSF19L, Validated applications: ICC, WB, Uniprot ID: Q969Z4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RELT
Gene Description RELT tumor necrosis factor receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
Immunogen GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14993, TNFRSF19L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969Z4
HTS Code 3002150000
Gene ID 84957
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RELT Antibody 100ul

Anti-RELT Antibody 100ul