DNLZ,bA413M3.2
  • DNLZ,bA413M3.2

Anti-DNLZ Antibody 100ul

Ref: AN-HPA062738-100ul
Anti-DNLZ

Información del producto

Polyclonal Antibody against Human DNLZ, Gene description: DNL-type zinc finger, Alternative Gene Names: bA413M3.2, C9orf151, HEP, RP11-413M3.2, TIMM15, ZIM17, Validated applications: ICC, Uniprot ID: Q5SXM8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DNLZ
Gene Description DNL-type zinc finger
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE
Immunogen LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA413M3.2, C9orf151, HEP, RP11-413M3.2, TIMM15, ZIM17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SXM8
HTS Code 3002150000
Gene ID 728489
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNLZ Antibody 100ul

Anti-DNLZ Antibody 100ul