KBTBD13,hCG_1645727
  • KBTBD13,hCG_1645727

Anti-KBTBD13 Antibody 100ul

Ref: AN-HPA062737-100ul
Anti-KBTBD13

Información del producto

Polyclonal Antibody against Human KBTBD13, Gene description: kelch repeat and BTB (POZ) domain containing 13, Alternative Gene Names: hCG_1645727, NEM6, Validated applications: IHC, Uniprot ID: C9JR72, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KBTBD13
Gene Description kelch repeat and BTB (POZ) domain containing 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
Immunogen LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hCG_1645727, NEM6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID C9JR72
HTS Code 3002150000
Gene ID 390594
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KBTBD13 Antibody 100ul

Anti-KBTBD13 Antibody 100ul