ORAOV1,TAOS1
  • ORAOV1,TAOS1

Anti-ORAOV1 Antibody 100ul

Ref: AN-HPA062696-100ul
Anti-ORAOV1

Información del producto

Polyclonal Antibody against Human ORAOV1, Gene description: oral cancer overexpressed 1, Alternative Gene Names: TAOS1, Validated applications: ICC, Uniprot ID: Q8WV07, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ORAOV1
Gene Description oral cancer overexpressed 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Immunogen GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TAOS1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WV07
HTS Code 3002150000
Gene ID 220064
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ORAOV1 Antibody 100ul

Anti-ORAOV1 Antibody 100ul