RPRML,MGC43894
  • RPRML,MGC43894

Anti-RPRML Antibody 25ul

Ref: AN-HPA062668-25ul
Anti-RPRML

Información del producto

Polyclonal Antibody against Human RPRML, Gene description: reprimo-like, Alternative Gene Names: MGC43894, Validated applications: IHC, Uniprot ID: Q8N4K4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPRML
Gene Description reprimo-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FLNHSGLEEVDGVGGGAGAAMGNRTHGLGTWLGCCPG
Immunogen FLNHSGLEEVDGVGGGAGAAMGNRTHGLGTWLGCCPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC43894
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N4K4
HTS Code 3002150000
Gene ID 388394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPRML Antibody 25ul

Anti-RPRML Antibody 25ul