ZNF605
  • ZNF605

Anti-ZNF605 Antibody 25ul

Ref: AN-HPA062655-25ul
Anti-ZNF605

Información del producto

Polyclonal Antibody against Human ZNF605, Gene description: zinc finger protein 605, Validated applications: IHC, Uniprot ID: Q86T29, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF605
Gene Description zinc finger protein 605
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
Immunogen CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86T29
HTS Code 3002150000
Gene ID 100289635
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF605 Antibody 25ul

Anti-ZNF605 Antibody 25ul