XDH,XO,XOR
  • XDH,XO,XOR

Anti-XDH Antibody 25ul

Ref: AN-HPA062641-25ul
Anti-XDH

Información del producto

Polyclonal Antibody against Human XDH, Gene description: xanthine dehydrogenase, Alternative Gene Names: XO, XOR, Validated applications: ICC, IHC, Uniprot ID: P47989, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name XDH
Gene Description xanthine dehydrogenase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
Immunogen GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names XO, XOR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P47989
HTS Code 3002150000
Gene ID 7498
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-XDH Antibody 25ul

Anti-XDH Antibody 25ul