BHLHA9,bHLHa9
  • BHLHA9,bHLHa9

Anti-BHLHA9 Antibody 25ul

Ref: AN-HPA062632-25ul
Anti-BHLHA9

Información del producto

Polyclonal Antibody against Human BHLHA9, Gene description: basic helix-loop-helix family, member a9, Alternative Gene Names: bHLHa9, BHLHF42, Validated applications: IHC, Uniprot ID: Q7RTU4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BHLHA9
Gene Description basic helix-loop-helix family, member a9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Immunogen SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHa9, BHLHF42
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7RTU4
HTS Code 3002150000
Gene ID 727857
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BHLHA9 Antibody 25ul

Anti-BHLHA9 Antibody 25ul