ADAMTS17,FLJ16363
  • ADAMTS17,FLJ16363

Anti-ADAMTS17 Antibody 25ul

Ref: AN-HPA062487-25ul
Anti-ADAMTS17

Información del producto

Polyclonal Antibody against Human ADAMTS17, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 17, Alternative Gene Names: FLJ16363, FLJ32769, Validated applications: ICC, Uniprot ID: Q8TE56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADAMTS17
Gene Description ADAM metallopeptidase with thrombospondin type 1 motif, 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS
Immunogen QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16363, FLJ32769
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TE56
HTS Code 3002150000
Gene ID 170691
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADAMTS17 Antibody 25ul

Anti-ADAMTS17 Antibody 25ul