DLK1,Delta1,FA1,pG2
  • DLK1,Delta1,FA1,pG2

Anti-DLK1 Antibody 25ul

Ref: AN-HPA062262-25ul
Anti-DLK1

Información del producto

Polyclonal Antibody against Human DLK1, Gene description: delta-like 1 homolog (Drosophila), Alternative Gene Names: Delta1, FA1, pG2, Pref-1, ZOG, Validated applications: ICC, IHC, Uniprot ID: P80370, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DLK1
Gene Description delta-like 1 homolog (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Immunogen FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Delta1, FA1, pG2, Pref-1, ZOG
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P80370
HTS Code 3002150000
Gene ID 8788
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DLK1 Antibody 25ul

Anti-DLK1 Antibody 25ul