PAGE3,CT16.6,GAGED1
  • PAGE3,CT16.6,GAGED1

Anti-PAGE3 Antibody 100ul

Ref: AN-HPA062248-100ul
Anti-PAGE3

Información del producto

Polyclonal Antibody against Human PAGE3, Gene description: P antigen family, member 3 (prostate associated), Alternative Gene Names: CT16.6, GAGED1, PAGE-3, Validated applications: IHC, Uniprot ID: Q5JUK9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAGE3
Gene Description P antigen family, member 3 (prostate associated)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV
Immunogen GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT16.6, GAGED1, PAGE-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JUK9
HTS Code 3002150000
Gene ID 139793
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PAGE3 Antibody 100ul

Anti-PAGE3 Antibody 100ul