SFTPB,SFTP3,SP-B
  • SFTPB,SFTP3,SP-B

Anti-SFTPB Antibody 100ul

Ref: AN-HPA062148-100ul
Anti-SFTPB

Información del producto

Polyclonal Antibody against Human SFTPB, Gene description: surfactant protein B, Alternative Gene Names: SFTP3, SP-B, Validated applications: IHC, Uniprot ID: P07988, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SFTPB
Gene Description surfactant protein B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS
Immunogen PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SFTP3, SP-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P07988
HTS Code 3002150000
Gene ID 6439
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SFTPB Antibody 100ul

Anti-SFTPB Antibody 100ul