ENPP1,M6S1,NPPS
  • ENPP1,M6S1,NPPS

Anti-ENPP1 Antibody 100ul

Ref: AN-HPA062066-100ul
Anti-ENPP1

Información del producto

Polyclonal Antibody against Human ENPP1, Gene description: ectonucleotide pyrophosphatase/phosphodiesterase 1, Alternative Gene Names: M6S1, NPPS, PC-1, PCA1, PDNP1, Validated applications: IHC, Uniprot ID: P22413, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ENPP1
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Immunogen GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names M6S1, NPPS, PC-1, PCA1, PDNP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22413
HTS Code 3002150000
Gene ID 5167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ENPP1 Antibody 100ul

Anti-ENPP1 Antibody 100ul