DUSP4,HVH2,MKP-2,TYP
  • DUSP4,HVH2,MKP-2,TYP

Anti-DUSP4 Antibody 25ul

Ref: AN-HPA061967-25ul
Anti-DUSP4

Información del producto

Polyclonal Antibody against Human DUSP4, Gene description: dual specificity phosphatase 4, Alternative Gene Names: HVH2, MKP-2, TYP, Validated applications: ICC, Uniprot ID: Q13115, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DUSP4
Gene Description dual specificity phosphatase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
Immunogen QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HVH2, MKP-2, TYP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13115
HTS Code 3002150000
Gene ID 1846
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP4 Antibody 25ul

Anti-DUSP4 Antibody 25ul