PCGF3,DONG1
  • PCGF3,DONG1

Anti-PCGF3 Antibody 100ul

Ref: AN-HPA061879-100ul
Anti-PCGF3

Información del producto

Polyclonal Antibody against Human PCGF3, Gene description: polycomb group ring finger 3, Alternative Gene Names: DONG1, FLJ36550, MGC40413, RNF3, RNF3A, Validated applications: ICC, Uniprot ID: Q3KNV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCGF3
Gene Description polycomb group ring finger 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Immunogen EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3KNV8
HTS Code 3002150000
Gene ID 10336
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCGF3 Antibody 100ul

Anti-PCGF3 Antibody 100ul